PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009595322.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 399aa    MW: 46157.9 Da    PI: 8.1981
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009595322.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-17188234148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd ll+++v+++G + W+ Ia+t+  gR +kqc++rw+++l
   XP_009595322.1 188 KGQWTIEEDRLLIQLVEKFGVRKWSQIAQTLK-GRIGKQCRERWHNHL 234
                      799****************************9.*************97 PP

2Myb_DNA-binding55.71.1e-17242282345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eEd +l+ a+++ G++ W+ Ia++++ gRt++++k++w+
   XP_009595322.1 242 LWTEEEDRILISAHAEVGNK-WSEIAKRIP-GRTENSIKNHWN 282
                      6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.202183238IPR017930Myb domain
SMARTSM007172.1E-14187236IPR001005SANT/Myb domain
PfamPF002491.7E-15188234IPR001005SANT/Myb domain
SuperFamilySSF466891.42E-31188281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-24189237IPR009057Homeodomain-like
CDDcd001674.17E-13191234No hitNo description
Gene3DG3DSA:1.10.10.607.5E-23238288IPR009057Homeodomain-like
PROSITE profilePS5129421.84239289IPR017930Myb domain
SMARTSM007174.4E-17239287IPR001005SANT/Myb domain
PfamPF002492.3E-16242282IPR001005SANT/Myb domain
CDDcd001673.93E-13243285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MIEDGSMQVK KIHTNENPSD MLTKVSTKKE VRDMQRTCRR ALKLETPVLP PSDYLQDFHH  60
LDLSFSLPTF NIPDHNFMIE TNGYDPLFDP FSNIKDNYSS MDQDFNFNYE FKPFDQNGTS  120
GSTLVNFNVV PDESSCITTA DNNGNYGQKE IGGRKNKKLI TKSNENSLSS SSMRKLGRGR  180
KKYSKSAKGQ WTIEEDRLLI QLVEKFGVRK WSQIAQTLKG RIGKQCRERW HNHLRPDIKK  240
DLWTEEEDRI LISAHAEVGN KWSEIAKRIP GRTENSIKNH WNATKRRQFS RRKCRTKWPR  300
PSSLLQNYIK SLNFEKGSND TTLNNNAPKL EPFELCDKGN IQQLVADYDF SQVPEFALDD  360
KLFDDLQIPY NELPQLMQAG EVNTEADLMD LISSANYEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-441882894105C-Myb DNA-Binding Domain
1msf_C2e-441882894105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009595322.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L27e-77MYB98_ARATH; Transcription factor MYB98
TrEMBLM1BJB51e-146M1BJB5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000466001e-146(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-76myb domain protein 98